Beta-Amyloid (1-40) Peptide (2024)

Table of Contents
Specifications Downloads You may also be interested in the following product(s) 1 % NH4OH solution - 300 µl Beta-Amyloid (1-42) SensoLyte® Anti-Mouse/Rat ß-Amyloid (1-40) Quantitative ELISA Kit Colorimetric - 1 kit Citations Combined Treatment with a BACE Inhibitor and Anti-Aβ Antibody Gantenerumab Enhances Amyloid Reduction in APPLondon Mice Microglial Amyloid-1-40 Phagocytosis Dysfunction Is Caused by High-Mobility Group Box Protein-1: Implications for the Pathological Progression of Alzheimer’s Disease A screening UHPLC–MS/MS method for the analysis of amyloid peptides in cerebrospinal fluid of preclinical species Regulation of Matrix Metalloproteinase 2 by Oligomeric Amyloid β Protein Structural and functional alterations in amyloid-β precursor protein induced by amyloid-β peptides CpG-ODNs induces up-regulated expression of chemokine CCL9 in mouse macrophages and microglia Gelsolin Restores A-Induced Alterations in Choroid Plexus Epithelium Mutant presenilin 1 increases the expression and activity of BACE1 Spatial Memory Impairment Without Apoptosis Induced by the Combination of Beta-Amyloid Oligomers and Cerebral Ischemia Is Related to Decreased Acetylcholine Release in Rats Aβ and tau form soluble complexes that may promote self aggregation of both into the insoluble forms observed in Alzheimer's disease CLAC Binds to Amyloid β Peptides through the Positively Charged Amino Acid Cluster within the Collagenous Domain 1 and Inhibits Formation of Amyloid Fibrils Effects of hydroxyl group variations on a flavonoid backbone toward modulation of metal-free and metal-induced amyloid-β aggregation Cilostazol suppresses β‐amyloid production by activating a disintegrin and metalloproteinase 10 via the upregulation of SIRT1‐coupled retinoic acid receptor‐β Insights into antiamyloidogenic properties of the green tea extract (-)-epigallocatechin-3-gallate toward metal-associated amyloid-β species. Bapineuzumab captures the N-terminus of the Alzheimer's disease amyloid-beta peptide in a helical conformation Effects of NK-4 in a Transgenic Mouse Model of Alzheimer's Disease Quantitation of amyloid beta peptides in CSF by surface enhanced MALDI-TOF Microglial Amyloid-β1-40 Phagocytosis Dysfunction is Caused by High-Mobility Group Box Protein-1: Implications for the Pathological Progression of Alzheimer’s Disease Somatostatin modulates insulin-degrading-enzyme metabolism: Implications for the regulation of microglia activity in AD Synthesis and characterization of IMPY derivatives that regulate metal-induced amyloid-β aggregation Inhibition of amyloid-β aggregation by coumarin analogs can be manipulated by functionalization of the aromatic center A partially folded structure of amyloid-beta(1-40) in an aqueous environment. Neuroprotective effect of honokiol and magnolol, compounds from Magnolia officinalis, on beta-amyloid-induced toxicity in PC12 cells Gelsolin Restores Aβ-Induced Alterations in Choroid Plexus Epithelium Comparative study of inhibition at multiple stages of amyloid-β self-assembly provides mechanisitic insight Dynamic fluorescence imaging analysis to investigate the cholesterol recruitment in lipid monolayer during the interaction between beta-amyloid (1-40) and lipid monolayers. Differential modification of Cys10 alters transthyretin's effect on beta-amyloid aggregation and toxicity The cleavage products of amyloid-β precursor protein are sorted to distinct carrier vesicles that are independently transported within neurites Simvastatin protects against amyloid β and HIV-1 tat-induced promoter activities of inflammatory genes in brain endothelial cells Bio-assay guided isolation and identification of anti-Alzheimer active compounds from the root of Angelica sinensis Identifying the minimal copper- and zinc-binding site sequence in amyloid-β peptides Enzymatic characteristics of I213T mutant presenilin-1/gamma-secretase in cell models and knock-in mouse brains: familial Alzheimer disease-linked mutation impairs gamma-site cleavage of amyloid precursor protein C-terminal fragment beta. Activation of 5-HT4 receptors inhibits secretion of β peptides and increase neuronal survival Soluble aggregates of the amyloid-β protein activate endothelial monolayers for adhesion and subsequent transmigration of monocyte cells Role of aggregation conditions in structure, stability, and toxicity of intermediates in the Aβ fibril formation pathway Early-onset behavioral and synaptic deficits in a mouse model of Alzheimer's disease Protofibril Formation of Amyloid β-Protein at Low pH via a Non-cooperative Elongation Mechanism Elucidating the Kinetics of β-Amyloid Fibril Formation Specific binding of amyloid-β-protein to IMR-32 neuroblastoma cell membrane Cholesterol depletion inhibits the degradation of amyloid beta-peptide in rat pheochromocytoma (PC12) cells. Transglutaminase catalyzes differential crosslinking of small heat shock proteins and amyloid-β Rapid method for measurement of surface tension in multiwell plates Insertion of Alzheimer's Aβ40 Peptide into Lipid Monolayers Glypican-1 as an Aβ binding HSPG in the human brain: Its localization in DIG domains and possible roles in the pathogenesis of Alzheimer’s disease Targeted control of kinetics of β-amyloid self-association by surface tension-modifying peptides Humanin peptides block calcium influx of rat hippocampal neurons by altering fibrogenesis of Aβ(1–40). Cholesterol Is an Important Factor Affecting the Membrane Insertion of β-Amyloid Peptide (Aβ1–40), Which May Potentially Inhibit the Fibril Formation A novel compound RS-0466 reverse β-amyloid-induced cytotoxcity through the Akt signaling pathway in vitro β-amyloid peptide-induced apoptosis regulated by a novel protein containing a G protein activation module Inflammatory cytokine levels are influenced by interactions between THP-1 monocytic, U-373 MG astrocytic, and SH-SY5Y neuronal cell lines of human origin Structure−function relationships for inhibitors of β-amyloid toxicity containing the recognition sequence KLVFF A mathematical model of the kinetics of β-amyloid fibril growth from the denatured state Interaction between β-amyloid and lens αB-crystallin Expression of prostaglandin E synthase mRNA is induced in beta-amyloid treated rat astrocytes The Molecular Chaperone αB-crystallin Enhances Amyloid β Neurotoxicity Complement-dependent proinflammatory properties of the Alzheimer's disease β-peptide Effect on memory of acute administration of naturally secreted fibrils and synthetic amyloid-beta peptides in an invertebrate model. Identifying the minimal Cu and Zn binding site sequence in amyloid beta peptides. Microchip electrophoresis profiling of Aβ peptides in the cerebrospinal fluid of patients with Alzheimer’s disease. Beta-amyloid peptide blocks the fast-inactivating K+ current in rat hippocampal neurons. Cholesterol depletion inhibits the degradation of amyloid β-peptide in rat pheochromocytoma (PC12) cells. A novel compound RS-0466 reverses β-amyloid-induced cytotoxicity through the Akt signaling pathway in vitro. N-truncation and pyroglutaminylation enhances the opsonizing capacity of Aβ-peptides and facilitates phagocytosis by macrophages and microglia. Quantification of Amyloid-β in Plasma by Simple and Highly Sensitive Immunoaffinity Enrichment and LC-MS/MS Assay References Aging renders the brain vulnerable to amyloid beta-protein neurotoxicity Amyloid plaque core protein in Alzheimer disease and Down syndrome Amyloid β-Protein (Aβ) 1–40 But Not Aβ1–42 Contributes to the Experimental Formation of Alzheimer Disease Amyloid Fibrils in Rat Brain Mechanisms of Neuronal Degeneration Reviewin Alzheimer’s Disease
    You are here:
  • Home
  • Our catalog
  • Products
  • Peptides
  • Catalog
  • Beta-Amyloid (1-40) Peptide

Peptides

$161.00 0 %

Check your price

  • Cat.Number : AS-24235-
  • Manufacturer Ref. :
  • Availability :

    In stock

    Delivery :

    Estimated restocking date :

Alternative choices

  • Overview
  • Specifications
  • Downloads
  • Related products
  • Citations
  • References

Aß (1-40) together with Aß (1-42) are two major C-terminal variants of the Aß protein constituting the majority of Aßs. These undergo post-secretory aggregation and deposition in the Alzheimer’s disease brain.
Electron microscopy of b-amyloid (1-40) stained with Thioflavin T (data generated by an AnaSpec scientist).

Specifications

Chemistry
Sequence one letter code
  • DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Sequence three letter code
  • H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH
CAS registry number
  • 131438-79-4
Molecular Formula
  • C194H295N53O58S
Molecular Mass/ Weight
  • 4329.9
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • Peak Area by HPLC ≥95%
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
  • beta-amyloid
  • beta-amyloid (1-40)
Research Area
  • Neuroscience
Sub-category Research Area
  • Alzheimer's Disease
Usage
  • Research use
Source
Source / Species
  • human

Downloads

AS-24236-5 Beta Amyloid (1-40) Peptide (EN) 2/24/2020 | PDF | TDS (Technical Data Sheet) | 209.475 KB
AS-24236 5 Beta Amyloid 1 40 (EN) 2/7/2020 | PDF | SDS (Safety Data Sheet) | 128.378 KB
AS-24236 Beta Amyloid 1 40 (EN) 2/7/2020 | PDF | SDS (Safety Data Sheet) | 128.37 KB
AS-24235 Beta Amyloid (1-40) Peptide (EN) 2/24/2020 | PDF | TDS (Technical Data Sheet) | 217.704 KB
AS-24236 Beta Amyloid (1-40) Peptide (EN) 2/24/2020 | PDF | TDS (Technical Data Sheet) | 209.475 KB
AS-24235 Beta Amyloid 1 40 (EN) 2/7/2020 | PDF | SDS (Safety Data Sheet) | 128.379 KB

You may also be interested in the following product(s)

Beta-Amyloid (1-40) Peptide (3)

1 % NH4OH solution - 300 µl

Cat.Number : AS-61322

$27.00 Excl. Tax

Beta-Amyloid (1-40) Peptide (4)

Beta-Amyloid (1-42)

Cat.Number : AS-20276

$341.00 Excl. Tax

Beta-Amyloid (1-40) Peptide (5)

SensoLyte® Anti-Mouse/Rat ß-Amyloid (1-40) Quantitative ELISA Kit Colorimetric - 1 kit

Cat.Number : AS-55553

$594.00 Excl. Tax

Citations

Combined Treatment with a BACE Inhibitor and Anti-Aβ Antibody Gantenerumab Enhances Amyloid Reduction in APPLondon Mice

J Neurosci . 2014 Aug 27 ;34(35) 11621 | DOI : 10.1523/JNEUROSCI.1405-14.2014

  • H. Jacobsen

Microglial Amyloid-1-40 Phagocytosis Dysfunction Is Caused by High-Mobility Group Box Protein-1: Implications for the Pathological Progression of Alzheimer’s Disease

Int J Alzheimers Dis . 2012 Feb 24 ;2012 11 | DOI : http://dx.doi.org/10.1155/2012/685739

  • K. Takata

A screening UHPLC–MS/MS method for the analysis of amyloid peptides in cerebrospinal fluid of preclinical species

Bioanalysis . 2010 Dec 23 ;3(1) 45 | DOI : 10.4155/bio.10.163

Regulation of Matrix Metalloproteinase 2 by Oligomeric Amyloid β Protein

Brain Res . 2011 Mar 02 ;1387 141 | DOI : 10.1016/j.brainres.2011.02.078

  • W. Li

Structural and functional alterations in amyloid-β precursor protein induced by amyloid-β peptides

J Alzheimers Dis . 2014 Apr 28 ;25(3) 547 | DOI : 10.3233/JAD-2011-101938

  • CP. Libeu

CpG-ODNs induces up-regulated expression of chemokine CCL9 in mouse macrophages and microglia

Cellular Immuno . 2010 Jan 01 ;260(2) 113 | DOI : https://doi.org/10.1016/j.cellimm.2009.10.001

  • C. Ravindran

Gelsolin Restores A-Induced Alterations in Choroid Plexus Epithelium

J Biomed and Biotech . 2010 Jan 19 ;2010 7 | DOI : http://dx.doi.org/10.1155/2010/805405

  • T. Vargas

Mutant presenilin 1 increases the expression and activity of BACE1

JBC . 2009 Feb 05 ;284 9027 | DOI : 10.1074/jbc.M805685200

  • L. Giliberto

Spatial Memory Impairment Without Apoptosis Induced by the Combination of Beta-Amyloid Oligomers and Cerebral Ischemia Is Related to Decreased Acetylcholine Release in Rats

J Pharmacol Sci . 2007 Nov 13 ;106 84 | DOI : 10.1254/jphs.fp0071648

  • T. Watanabe

Aβ and tau form soluble complexes that may promote self aggregation of both into the insoluble forms observed in Alzheimer's disease

PNAS . 2006 Feb 07 ;103(6) 1953 | DOI : https://doi.org/10.1073/pnas.0509386103

  • J-P. Guo

CLAC Binds to Amyloid β Peptides through the Positively Charged Amino Acid Cluster within the Collagenous Domain 1 and Inhibits Formation of Amyloid Fibrils

JBC . 2004 Dec 21 ;280 15484 | DOI : 10.1074/jbc.M413340200

  • Y. Osada

Effects of hydroxyl group variations on a flavonoid backbone toward modulation of metal-free and metal-induced amyloid-β aggregation

Inorg. Chem. Front. . 2016 Jan 13 ;3 381 | DOI : 10.1039/C5QI00219B

  • HJ. Lee

Cilostazol suppresses β‐amyloid production by activating a disintegrin and metalloproteinase 10 via the upregulation of SIRT1‐coupled retinoic acid receptor‐β

J Neurosci Res. . 2014 Jun 05 ;92(11) 1581 | DOI : 10.1002/jnr.23421

  • HR. Lee

Insights into antiamyloidogenic properties of the green tea extract (-)-epigallocatechin-3-gallate toward metal-associated amyloid-β species.

Proc Natl Acad Sci U S A . 2013 Feb 20 ;110(10) 3743 | DOI : 10.1073/pnas.1220326110

  • SJ. Hyung

Bapineuzumab captures the N-terminus of the Alzheimer's disease amyloid-beta peptide in a helical conformation

Scientific Rpt . 2013 Feb 18 ;3 | DOI : 10.1038/srep01302

  • LA. Miles

Effects of NK-4 in a Transgenic Mouse Model of Alzheimer's Disease

PLoS One. . 2012 Jan 04 ;7(1) e30007 | DOI : https://doi.org/10.1371/journal.pone.0030007

  • H. Ohta

Quantitation of amyloid beta peptides in CSF by surface enhanced MALDI-TOF

Methods Mol Biol . 2011 Oct 12 ;818 227 | DOI : 10.1007/978-1-61779-418-6_16

  • E. Takahashi

Microglial Amyloid-β1-40 Phagocytosis Dysfunction is Caused by High-Mobility Group Box Protein-1: Implications for the Pathological Progression of Alzheimer’s Disease

Int J Alz Dis . 2012 May 08 ;2012 685739 | DOI : https://doi.org/10.1155/2012/685739

  • K. Takata

Somatostatin modulates insulin-degrading-enzyme metabolism: Implications for the regulation of microglia activity in AD

PLoS One. . 2012 Apr 03 ;7(4) e34376 | DOI : 10.1371/journal.pone.0034376

  • G. Tundo

Synthesis and characterization of IMPY derivatives that regulate metal-induced amyloid-β aggregation

Metallomics. . 2011 Jan 06 ;3(3) 284 | DOI : 10.1039/c0mt00077a

  • JS. Choi

Inhibition of amyloid-β aggregation by coumarin analogs can be manipulated by functionalization of the aromatic center

Bioorg Med Chem. . 2011 Mar 12 ;19(8) 2596 | DOI : 10.1016/j.bmc.2011.03.010

  • D. Soto-Ortega

A partially folded structure of amyloid-beta(1-40) in an aqueous environment.

Biochem Biophys Res Commun . 2011 Jun 25 ;411(2) 312 | DOI : 10.1016/j.bbrc.2011.06.133

  • S. Vivekanandan

Neuroprotective effect of honokiol and magnolol, compounds from Magnolia officinalis, on beta-amyloid-induced toxicity in PC12 cells

Phytother Res. . 2010 Jun 01 ;24(10) 1538 | DOI : 10.1002/ptr.3178

  • C. Hoi

Gelsolin Restores Aβ-Induced Alterations in Choroid Plexus Epithelium

J Biomed Biotechnol . 2010 Mar 25 ;2010 805405 | DOI : https://doi.org/10.1155/2010/805405

  • T. Vargas

Comparative study of inhibition at multiple stages of amyloid-β self-assembly provides mechanisitic insight

Mol Pharmacol. . 2009 May 29 ;76(2) 405 | DOI : 10.1124/mol.109.055301

  • TJ. Davis

Dynamic fluorescence imaging analysis to investigate the cholesterol recruitment in lipid monolayer during the interaction between beta-amyloid (1-40) and lipid monolayers.

Colloids Surf B Biointerfaces. . 2009 Jun 23 ;74(1) 59 | DOI : 10.1016/j.colsurfb.2009.06.027

  • MS. Lin

Differential modification of Cys10 alters transthyretin's effect on beta-amyloid aggregation and toxicity

Protein Eng Des Sel . 2009 Jun 23 ;22(8) 479 | DOI : 10.1093/protein/gzp025

  • L. Liu

The cleavage products of amyloid-β precursor protein are sorted to distinct carrier vesicles that are independently transported within neurites

J Neurosci. . 2009 Mar 18 ;29(11) 3565 | DOI : 10.1523/JNEUROSCI.2558-08.2009

  • V. Muresan

Simvastatin protects against amyloid β and HIV-1 tat-induced promoter activities of inflammatory genes in brain endothelial cells

Mol Pharmacol . 2008 Feb 14 ;73(5) 1424 | DOI : 10.1124/mol.107.042028

  • IE. Andras

Bio-assay guided isolation and identification of anti-Alzheimer active compounds from the root of Angelica sinensis

Food Chem . 2008 Sep 23 ;114(1) 246 | DOI : https://doi.org/10.1016/j.foodchem.2008.09.046

  • CC. Ho

Identifying the minimal copper- and zinc-binding site sequence in amyloid-β peptides

J Biol Chem . 2008 Jan 30 ;283(16) 10784 | DOI : 10.1074/jbc.M707109200

  • V. Minicozzi

Enzymatic characteristics of I213T mutant presenilin-1/gamma-secretase in cell models and knock-in mouse brains: familial Alzheimer disease-linked mutation impairs gamma-site cleavage of amyloid precursor protein C-terminal fragment beta.

J Biol Chem . 2008 Apr 21 ;283(24) 16488 | DOI : 10.1074/jbc.M801279200

  • M. Shimojo

Activation of 5-HT4 receptors inhibits secretion of β peptides and increase neuronal survival

Exp Neurol. . 2016 Sep 15 ;203(1) 274 | DOI : 10.1016/j.expneurol.2006.07.021

  • S. Cho

Soluble aggregates of the amyloid-β protein activate endothelial monolayers for adhesion and subsequent transmigration of monocyte cells

J Neurochem . 2007 Oct 22 ;104(2) 500 | DOI : 10.1111/j.1471-4159.2007.04988.x

  • FJ. Gonzales-Velasquez

Role of aggregation conditions in structure, stability, and toxicity of intermediates in the Aβ fibril formation pathway

Protein Sci . 2007 Apr 01 ;16(4) 723 | DOI : 10.1110/ps.062514807

  • S. Lee

Early-onset behavioral and synaptic deficits in a mouse model of Alzheimer's disease

PNAS . 2006 Mar 28 ;103(13) 5161 | DOI : https://doi.org/10.1073/pnas.0600948103

  • JS. Jacobsen

Protofibril Formation of Amyloid β-Protein at Low pH via a Non-cooperative Elongation Mechanism

J Biol Chem . 2005 May 28 ;280(34) 30001 | DOI : 10.1074/jbc.M500052200

  • R. Carrotta

Elucidating the Kinetics of β-Amyloid Fibril Formation

ACS Symposium Series . 2005 Sep 29 ;916(13) | DOI : 10.1021/bk-2005-0916.ch009

  • NJ. Edwin

Specific binding of amyloid-β-protein to IMR-32 neuroblastoma cell membrane

J Pept Res . 2008 Dec 05 ;65(5) 485 | DOI : https://doi.org/10.1111/j.1399-3011.2005.00250.x

  • S. Inaba

Cholesterol depletion inhibits the degradation of amyloid beta-peptide in rat pheochromocytoma (PC12) cells.

Neurosci Lett. . 2005 Sep 09 ;391(1-2) 71 | DOI : 10.1016/j.neulet.2005.08.034

  • XZ. Sun

Transglutaminase catalyzes differential crosslinking of small heat shock proteins and amyloid-β

FEBS Lett . 2004 Oct 08 ;576(1-2) 57 | DOI : 10.1016/j.febslet.2004.08.062

  • S. Boros

Rapid method for measurement of surface tension in multiwell plates

Lab Invest. . 2004 Jan 19 ;84(4) 523 | DOI : 10.1038/labinvest.3700054

  • MG. Cottingham

Insertion of Alzheimer's Aβ40 Peptide into Lipid Monolayers

Biophys J. . 2004 Sep 01 ;87(3) 1732 | DOI : 10.1529/biophysj.104.043265

  • C. Ege

Glypican-1 as an Aβ binding HSPG in the human brain: Its localization in DIG domains and possible roles in the pathogenesis of Alzheimer’s disease

FASEB J . 2004 Apr 14 ;18(9) | DOI : https://doi.org/10.1096/fj.03-1040fje

  • N. Watanabe

Targeted control of kinetics of β-amyloid self-association by surface tension-modifying peptides

J Biol Chem. . 2003 Aug 13 ;278(42) 40730 | DOI : 10.1074/jbc.M305466200

  • JR. Kim

Humanin peptides block calcium influx of rat hippocampal neurons by altering fibrogenesis of Aβ(1–40).

Peptides . 2003 Jul 09 ;24(5) 679 | DOI : 10.1016/s0196-9781(03)00131-1

  • P. Zou

Cholesterol Is an Important Factor Affecting the Membrane Insertion of β-Amyloid Peptide (Aβ1–40), Which May Potentially Inhibit the Fibril Formation

JBC . 2001 Dec 10 ;277(8) 6273 | DOI : 10.1074/jbc.M104146200

  • SR. Ji

A novel compound RS-0466 reverse β-amyloid-induced cytotoxcity through the Akt signaling pathway in vitro

Eur J Pharmacol. . 2012 Dec 13 ;457(1) 11 | DOI : 10.1016/s0014-2999(02)02657-2

  • Y. Nakagami

β-amyloid peptide-induced apoptosis regulated by a novel protein containing a G protein activation module

J Biol Chem. . 2001 Feb 20 ;276(22) 18748 | DOI : 10.1074/jbc.M011161200

  • EM. Kajkowski

Inflammatory cytokine levels are influenced by interactions between THP-1 monocytic, U-373 MG astrocytic, and SH-SY5Y neuronal cell lines of human origin

Neurosci Lett. . 2001 Nov 02 ;313(1-2) 41 | DOI : 10.1016/s0304-3940(01)02251-0

  • A. Klegeris

Structure−function relationships for inhibitors of β-amyloid toxicity containing the recognition sequence KLVFF

Biochemistry. . 2001 Jul 03 ;40(26) 7882 | DOI : 10.1021/bi002734u

  • TL. Lowe

A mathematical model of the kinetics of β-amyloid fibril growth from the denatured state

Biophys J . 2001 Sep 01 ;81(3) 1805 | DOI : 10.1016/S0006-3495(01)75831-6

  • MM. Pallitto
  • RM. Murphy

Interaction between β-amyloid and lens αB-crystallin

FEBS Lett . 2000 Nov 03 ;484(2) 98 | DOI : https://doi.org/10.1016/S0014-5793(00)02136-0

  • JJN. Liang

Expression of prostaglandin E synthase mRNA is induced in beta-amyloid treated rat astrocytes

Neurosci Lett . 2000 Apr 14 ;283(3) 221 | DOI : 10.1016/s0304-3940(00)00926-5

  • K. Satoh

The Molecular Chaperone αB-crystallin Enhances Amyloid β Neurotoxicity

Res Communi . 2002 May 25 ;262(1) 152 | DOI : https://doi.org/10.1006/bbrc.1999.1167

  • GJJ. Stege

Complement-dependent proinflammatory properties of the Alzheimer's disease β-peptide

JEM . 1998 Aug 03 ;188(3) 431 | DOI : https://doi.org/10.1084/jem.188.3.431

  • BM. Bradt

Effect on memory of acute administration of naturally secreted fibrils and synthetic amyloid-beta peptides in an invertebrate model.

Neurobiol Learn Mem . 2007 Oct 24 ;89(4) 407 | DOI : 10.1016/j.nlm.2007.08.011

  • M. Feld

Identifying the minimal Cu and Zn binding site sequence in amyloid beta peptides.

J Biol Chem . 2008 Jan 30 ;283(16) 10784 | DOI : 10.1074/jbc.M707109200.

  • V. Minicozzi

Microchip electrophoresis profiling of Aβ peptides in the cerebrospinal fluid of patients with Alzheimer’s disease.

Anal Chem . 2010 Sep 15 ;82(18) 7611 | DOI : 10.1021/ac101337n

  • M. Reza

Beta-amyloid peptide blocks the fast-inactivating K+ current in rat hippocampal neurons.

Biophys J 70, 296. . 1996 Jan 01 ;70(1) 296 | DOI : 10.1016/S0006-3495(96)79570-X

  • TA. Good

Cholesterol depletion inhibits the degradation of amyloid β-peptide in rat pheochromocytoma (PC12) cells.

Neurosci. Lett. . 2005 Sep 09 ;391(1-2) 71 | DOI : 10.1016/j.neulet.2005.08.034.

  • ZX. Sun

A novel compound RS-0466 reverses β-amyloid-induced cytotoxicity through the Akt signaling pathway in vitro.

Eur J Pharmacol . 2002 Dec 13 ;457(1) 11 | DOI : 10.1016/s0014-2999(02)02657-2

  • Y. Nakagami

N-truncation and pyroglutaminylation enhances the opsonizing capacity of Aβ-peptides and facilitates phagocytosis by macrophages and microglia.

Brain Behav Immun . 2014 May 27 ;41 116 | DOI : 10.1016/j.bbi.2014.05.003.

  • M. Condic

Quantification of Amyloid-β in Plasma by Simple and Highly Sensitive Immunoaffinity Enrichment and LC-MS/MS Assay

J Applied Lab Med . 2021 Jul 01 ;6(4) 834 | DOI : https://doi-org.lib-proxy.fullerton.edu/10.1093/jalm/jfaa225

  • T. Iino
  • et al

References

Aging renders the brain vulnerable to amyloid beta-protein neurotoxicity

Nat Med . 1998 Jul 15 ;4(7) 827 | DOI : https://doi.org/10.1038/nm0798-827

  • C. Geula
  • et al

Amyloid plaque core protein in Alzheimer disease and Down syndrome

Proc Nat Acad Sci USA . 1985 Jun 01 ;82(12) 4245 | DOI : https://doi.org/10.1073/pnas.82.12.4245

  • CL. Masters
  • et al

Amyloid β-Protein (Aβ) 1–40 But Not Aβ1–42 Contributes to the Experimental Formation of Alzheimer Disease Amyloid Fibrils in Rat Brain

J Neurosci . 1997 Nov 01 ;17(21) 8187 | DOI : https://doi.org/10.1523/JNEUROSCI.17-21-08187.1997

  • R. Shin
  • et al

Mechanisms of Neuronal Degeneration Reviewin Alzheimer’s Disease

Neuron . 1996 Jan 01 ;16 921 | DOI : 10.1016/s0896-6273(00)80115-4

  • BA. Yankner
Beta-Amyloid (1-40) Peptide (2024)
Top Articles
Latest Posts
Article information

Author: Golda Nolan II

Last Updated:

Views: 6166

Rating: 4.8 / 5 (78 voted)

Reviews: 93% of readers found this page helpful

Author information

Name: Golda Nolan II

Birthday: 1998-05-14

Address: Suite 369 9754 Roberts Pines, West Benitaburgh, NM 69180-7958

Phone: +522993866487

Job: Sales Executive

Hobby: Worldbuilding, Shopping, Quilting, Cooking, Homebrewing, Leather crafting, Pet

Introduction: My name is Golda Nolan II, I am a thoughtful, clever, cute, jolly, brave, powerful, splendid person who loves writing and wants to share my knowledge and understanding with you.